Lineage for d1qcxa_ (1qcx A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069178Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069179Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2069226Family b.80.1.2: Pectin lyase [51133] (1 protein)
  6. 2069227Protein Pectin lyase [51134] (2 species)
  7. 2069232Species Aspergillus niger, type B [TaxId:5061] [51136] (1 PDB entry)
  8. 2069233Domain d1qcxa_: 1qcx A: [28028]

Details for d1qcxa_

PDB Entry: 1qcx (more details), 1.7 Å

PDB Description: pectin lyase b
PDB Compounds: (A:) pectin lyase b

SCOPe Domain Sequences for d1qcxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcxa_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type B [TaxId: 5061]}
agvvgaaegfahgvtgggsaspvyptttdelvsylgdneprviildqtfdftgtegtett
tgcapwgtasqcqvainlhswcdnyqasapkvsvtydkagilpitvnsnksivgqgtkgv
ikgkglrvvsgaknviiqniavtdinpkyvwggdaitvddsdlvwidhvttarigrqhiv
lgtsadnrvtisyslidgrsdysatcnghhywgvyldgsndmvtlkgnyfynlsgrmpkv
qgntllhavnnlfhnfdghafeigtggyvlaegnvfqdvnvvvetpisgqlfsspdantn
qqcasvfgrscqlnafgnsgsmsgsdtsiiskfagktiaaahppgaiaqwtmknagqgk

SCOPe Domain Coordinates for d1qcxa_:

Click to download the PDB-style file with coordinates for d1qcxa_.
(The format of our PDB-style files is described here.)

Timeline for d1qcxa_: