Lineage for d4ylqh_ (4ylq H:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1793549Protein Coagulation factor VIIa [50550] (1 species)
  7. 1793550Species Human (Homo sapiens) [TaxId:9606] [50551] (50 PDB entries)
    Uniprot P08709 213-466 ! Uniprot P08709 213-446
  8. 1793552Domain d4ylqh_: 4ylq H: [280180]
    automated match to d4jzeh_
    complexed with 0z7, bgc, ca, fuc, pol, tma, xys

Details for d4ylqh_

PDB Entry: 4ylq (more details), 1.4 Å

PDB Description: crystal structure of a fviia-trypsin chimera (ft) in complex with soluble tissue factor
PDB Compounds: (H:) Coagulation factor VII

SCOPe Domain Sequences for d4ylqh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ylqh_ b.47.1.2 (H:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd
lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert
lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdceasfpgkiteymfcagysdgsk
dsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmrseprp
gvllrapfp

SCOPe Domain Coordinates for d4ylqh_:

Click to download the PDB-style file with coordinates for d4ylqh_.
(The format of our PDB-style files is described here.)

Timeline for d4ylqh_: