SCOPe 2.06: Domain d4rx6b_: 4rx6 B:

Lineage for d4rx6b_ (4rx6 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (16 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [269820] (2 PDB entries)

8. Domain d4rx6b_: 4rx6 B: [280172]
   Other proteins in same PDB: d4rx6a2
   automated match to d2piia_
   complexed with atp

Details for d4rx6b_

PDB Entry: 4rx6, 2.6 Å

PDB Description: structure of b. subtilis glnk-atp complex to 2.6 angstrom

PDB Compounds: (B:) Nitrogen regulatory PII-like protein

SCOPe Domain Sequences for d4rx6b_:

Sequence; same for both SEQRES and ATOM records:

>d4rx6b_ d.58.5.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
sgqmfkveivtrpanfeklkqelgkigvtsltfsnvhgcglqkahtelyrgvkiesnvye
rlkieivvskvpvdqvtetakrvlktgspgdgkifvyeisntinirtgeegpeal

Timeline for d4rx6b_:

• d4rx6b_ first appeared in SCOPe 2.05
  
• d4rx6b_ appears in SCOPe 2.07
  
• d4rx6b_ appears in the current release, SCOPe 2.08