SCOPe 2.08: Domain d5fdaa1: 5fda A:1-160

Lineage for d5fdaa1 (5fda A:1-160)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (28 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [256028] (3 PDB entries)

8. Domain d5fdaa1: 5fda A:1-160 [280165]
   Other proteins in same PDB: d5fdaa2
   automated match to d4qi9a_
   complexed with cl

Details for d5fdaa1

PDB Entry: 5fda, 1.55 Å

PDB Description: the high resolution structure of apo form dihydrofolate reductase from yersinia pestis at 1.55 a

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d5fdaa1:

Sequence; same for both SEQRES and ATOM records:

>d5fdaa1 c.71.1.0 (A:1-160) automated matches {Yersinia pestis [TaxId: 214092]}
miisliaalaadrvigmenampwhlpadlawfkrntlnkpvimgrktfesigrplpgrln
ivissqpgtdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidaev
ggdthfpdyepdewesvfsefhdadeanshsycfeilerr

Timeline for d5fdaa1:

• d5fdaa1 first appeared in SCOPe 2.05, called d5fdaa_
  
• d5fdaa1 appears in SCOPe 2.07