SCOPe 2.05: Domain d5fdaa_: 5fda A:

Lineage for d5fdaa_ (5fda A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (19 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [256028] (3 PDB entries)

8. Domain d5fdaa_: 5fda A: [280165]
   automated match to d4qi9a_
   complexed with cl

Details for d5fdaa_

PDB Entry: 5fda, 1.55 Å

PDB Description: the high resolution structure of apo form dihydrofolate reductase from yersinia pestis at 1.55 a

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d5fdaa_:

Sequence; same for both SEQRES and ATOM records:

>d5fdaa_ c.71.1.0 (A:) automated matches {Yersinia pestis [TaxId: 214092]}
amiisliaalaadrvigmenampwhlpadlawfkrntlnkpvimgrktfesigrplpgrl
nivissqpgtdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidae
vggdthfpdyepdewesvfsefhdadeanshsycfeilerr

Timeline for d5fdaa_:

• d5fdaa_ is new in SCOPe 2.05-stable
  
• d5fdaa_ is called d5fdaa1 in SCOPe 2.06
  
• d5fdaa_ appears in the current release, SCOPe 2.08, called d5fdaa1