Lineage for d5c3na_ (5c3n A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2066902Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2066903Protein automated matches [190438] (24 species)
    not a true protein
  7. 2067082Species Middle east respiratory syndrome coronavirus [TaxId:1335626] [272740] (5 PDB entries)
  8. 2067097Domain d5c3na_: 5c3n A: [280120]
    automated match to d2ynaa_

Details for d5c3na_

PDB Entry: 5c3n (more details), 3 Å

PDB Description: crystal structure of mers coronavirus main protease in spacegroup c2221
PDB Compounds: (A:) Orf1a protein

SCOPe Domain Sequences for d5c3na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c3na_ b.47.1.0 (A:) automated matches {Middle east respiratory syndrome coronavirus [TaxId: 1335626]}
sglvkmshpsgdveacmvqvtcgsmtlnglwldntvwcprhvmcpadqlsdpnydallis
mtnhsfsvqkhigapanlrvvghamqgtllkltvdvanpstpaytfttvkpgaafsvlac
yngrptgtftvvmrpnytikgsflcgscgsvgytkegsvinfcymhqmelangthtgsaf
dgtmygafmdkqvhqvqltdkycsvnvvawlyaailngcawfvkpnrtsvvsfnewalan
qftefvgtqsvdmlavktgvaieqllyaiqqlytgfqgkqilgstmledeftpedvnmqi
m

SCOPe Domain Coordinates for d5c3na_:

Click to download the PDB-style file with coordinates for d5c3na_.
(The format of our PDB-style files is described here.)

Timeline for d5c3na_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5c3nb_