SCOPe 2.07: Domain d5f6qa1: 5f6q A:1-139

Lineage for d5f6qa1 (5f6q A:1-139)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [226573] (4 PDB entries)

8. Domain d5f6qa1: 5f6q A:1-139 [280032]
   Other proteins in same PDB: d5f6qa2, d5f6qb2
   automated match to d4ir0a_
   complexed with cl, gol, k, so4, zn

Details for d5f6qa1

PDB Entry: 5f6q, 1.52 Å

PDB Description: crystal structure of metallothiol transferase from bacillus anthracis str. ames

PDB Compounds: (A:) Metallothiol transferase fosB 2

SCOPe Domain Sequences for d5f6qa1:

Sequence; same for both SEQRES and ATOM records:

>d5f6qa1 d.32.1.0 (A:1-139) automated matches {Bacillus anthracis [TaxId: 198094]}
mlqginhicfsvsnleksiefyqkilqakllvkgrklayfdlnglwialnveediprnei
kqsythmaftvtnealdhlkevliqndvnilpgrerderdqrslyftdpdghkfefhtgt
lqnrleyykedkkhmtfyi

Timeline for d5f6qa1:

• d5f6qa1 first appeared in SCOPe 2.05, called d5f6qa_
  
• d5f6qa1 appears in SCOPe 2.06
  
• d5f6qa1 appears in the current release, SCOPe 2.08