SCOPe 2.08: Domain d5a93a_: 5a93 A:

Lineage for d5a93a_ (5a93 A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Escherichia coli, TOHO-1 [TaxId:562] [56608] (27 PDB entries)

8. Domain d5a93a_: 5a93 A: [279866]
   automated match to d2zq7a_
   complexed with cef, so4

Details for d5a93a_

PDB Entry: 5a93, 1.6 Å

PDB Description: 293k joint x-ray neutron with cefotaxime: exploring the mechanism of beta-lactam ring protonation in the class a beta-lactamase acylation mechanism using neutron and x-ray crystallography

PDB Compounds: (A:) beta-lactamase ctx-m-97

SCOPe Domain Sequences for d5a93a_:

Sequence; same for both SEQRES and ATOM records:

>d5a93a_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TOHO-1 [TaxId: 562]}
svqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdk
hllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkv
tafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraqlv
twlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeq
kaenrndilaaaakivthgf

Timeline for d5a93a_:

• d5a93a_ first appeared in SCOPe 2.05
  
• d5a93a_ appears in SCOPe 2.07