Lineage for d4rsnb1 (4rsn B:0-455)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005433Species Bacillus megaterium [TaxId:1404] [188479] (5 PDB entries)
  8. 2005441Domain d4rsnb1: 4rsn B:0-455 [279758]
    Other proteins in same PDB: d4rsna2, d4rsnb2
    automated match to d4kpaa_
    complexed with hem; mutant

Details for d4rsnb1

PDB Entry: 4rsn (more details), 2.7 Å

PDB Description: crystal structure of the e267v mutant of cytochrome p450 bm3
PDB Compounds: (B:) Bifunctional P-450/NADPH-P450 reductase

SCOPe Domain Sequences for d4rsnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rsnb1 a.104.1.1 (B:0-455) automated matches {Bacillus megaterium [TaxId: 1404]}
mtikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapglvtrflssqrlik
eacdesrfdknlsqalkfvrdfagdglvtswtheknwkkahnillpsfsqqamkgyhamm
vdiavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvr
aldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmln
gkdpetgeplddeniryqiitfliaghvttsgllsfalyflvknphvlqkaaeeaarvlv
dpvpsykqvkqlkyvdmvlnealrlwptapafslyakedtvlggkyplekgdelmvlipq
lhrdktiwgddveefrperfenpsaipqhafkpfgngqracpgqqfalheatlvlgmmlk
hfdfedhtnyeldiketltlkpegfvvkakskkipl

SCOPe Domain Coordinates for d4rsnb1:

Click to download the PDB-style file with coordinates for d4rsnb1.
(The format of our PDB-style files is described here.)

Timeline for d4rsnb1:

  • d4rsnb1 first appeared in SCOPe 2.05, called d4rsnb_

View in 3D
Domains from same chain:
(mouse over for more information)
d4rsnb2