![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) ![]() |
![]() | Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins) |
![]() | Protein automated matches [192998] (1 species) not a true protein |
![]() | Species Sporosarcina pasteurii [TaxId:1474] [193000] (2 PDB entries) |
![]() | Domain d5a6tb_: 5a6t B: [279672] Other proteins in same PDB: d5a6ta_ automated match to d4ubpb_ complexed with edo, ni, so3, so4 |
PDB Entry: 5a6t (more details), 1.65 Å
SCOPe Domain Sequences for d5a6tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a6tb_ b.85.3.1 (B:) automated matches {Sporosarcina pasteurii [TaxId: 1474]} nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg ve
Timeline for d5a6tb_: