SCOPe 2.06: Domain d5a6tb_: 5a6t B:

Lineage for d5a6tb_ (5a6t B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (2 families)

5. Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)

6. Protein automated matches [192998] (1 species)
   not a true protein

7. Species Sporosarcina pasteurii [TaxId:1474] [193000] (2 PDB entries)

8. Domain d5a6tb_: 5a6t B: [279672]
   Other proteins in same PDB: d5a6ta_
   automated match to d4ubpb_
   complexed with edo, ni, so3, so4

Details for d5a6tb_

PDB Entry: 5a6t, 1.65 Å

PDB Description: 1.65 a resolution sulphite inhibited sporosarcina pasteurii urease

PDB Compounds: (B:) urease subunit beta

SCOPe Domain Sequences for d5a6tb_:

Sequence; same for both SEQRES and ATOM records:

>d5a6tb_ b.85.3.1 (B:) automated matches {Sporosarcina pasteurii [TaxId: 1474]}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

Timeline for d5a6tb_:

• d5a6tb_ first appeared in SCOPe 2.05
  
• d5a6tb_ appears in SCOPe 2.07
  
• d5a6tb_ appears in the current release, SCOPe 2.08