Lineage for d1dmyb_ (1dmy B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 380456Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 380457Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 380458Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 380459Protein Carbonic anhydrase [51071] (10 species)
  7. 380651Species Mouse (Mus musculus), liver, isozyme V [TaxId:10090] [51078] (4 PDB entries)
  8. 380657Domain d1dmyb_: 1dmy B: [27962]
    complexed with azm, zn; mutant

Details for d1dmyb_

PDB Entry: 1dmy (more details), 2.45 Å

PDB Description: complex between murine mitochondrial carbonic anyhdrase v and the transition state analogue acetazolamide

SCOP Domain Sequences for d1dmyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dmyb_ b.74.1.1 (B:) Carbonic anhydrase {Mouse (Mus musculus), liver, isozyme V}
gtrqspiniqwkdsvydpqlaplrvsydaascrylwntgyffqvefddscedsgisggpl
gnhyrlkqfhfhwgatdewgsehavdghtypaelhlvhwnstkyenykkasvgenglavi
gvflklgahhqalqklvdvlpevrhkdtqvamgpfdpsclmpacrdywtypgslttppla
esvtwivqktpvevspsqlsmfrtllfsgrgeeedvmvnnyrplqplrdrklrssfr

SCOP Domain Coordinates for d1dmyb_:

Click to download the PDB-style file with coordinates for d1dmyb_.
(The format of our PDB-style files is described here.)

Timeline for d1dmyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dmya_