Lineage for d1dmyb_ (1dmy B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2401367Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2401368Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2401369Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2401370Protein Carbonic anhydrase [51071] (10 species)
  7. 2402215Species Mouse (Mus musculus), liver, isozyme V [TaxId:10090] [51078] (4 PDB entries)
  8. 2402219Domain d1dmyb_: 1dmy B: [27962]
    complexed with azm, zn

Details for d1dmyb_

PDB Entry: 1dmy (more details), 2.45 Å

PDB Description: complex between murine mitochondrial carbonic anyhdrase v and the transition state analogue acetazolamide
PDB Compounds: (B:) murine carbonic anhydrase v

SCOPe Domain Sequences for d1dmyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dmyb_ b.74.1.1 (B:) Carbonic anhydrase {Mouse (Mus musculus), liver, isozyme V [TaxId: 10090]}
gtrqspiniqwkdsvydpqlaplrvsydaascrylwntgyffqvefddscedsgisggpl
gnhyrlkqfhfhwgatdewgsehavdghtypaelhlvhwnstkyenykkasvgenglavi
gvflklgahhqalqklvdvlpevrhkdtqvamgpfdpsclmpacrdywtypgslttppla
esvtwivqktpvevspsqlsmfrtllfsgrgeeedvmvnnyrplqplrdrklrssfr

SCOPe Domain Coordinates for d1dmyb_:

Click to download the PDB-style file with coordinates for d1dmyb_.
(The format of our PDB-style files is described here.)

Timeline for d1dmyb_: