Lineage for d5elmc1 (5elm C:1-116)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156150Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2156839Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families) (S)
  5. 2156858Family c.78.2.0: automated matches [227233] (1 protein)
    not a true family
  6. 2156859Protein automated matches [226982] (4 species)
    not a true protein
  7. 2156871Species Escherichia coli [TaxId:562] [279460] (2 PDB entries)
  8. 2156880Domain d5elmc1: 5elm C:1-116 [279470]
    Other proteins in same PDB: d5elma3, d5elmb3, d5elmc3, d5elmd3
    automated match to d3ojca1
    complexed with glu, gol, no3

Details for d5elmc1

PDB Entry: 5elm (more details), 2 Å

PDB Description: crystal structure of l-aspartate/glutamate specific racemase in complex with l-glutamate
PDB Compounds: (C:) Asp/Glu_racemase family protein

SCOPe Domain Sequences for d5elmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5elmc1 c.78.2.0 (C:1-116) automated matches {Escherichia coli [TaxId: 562]}
mktigllggmswestipyyrlinegikqrlgglhsaqvllhsvdfheieecqrrgewdkt
gdilaeaalglqragaegivlctntmhkvadaiesrctlpflhiadatgraitgag

SCOPe Domain Coordinates for d5elmc1:

Click to download the PDB-style file with coordinates for d5elmc1.
(The format of our PDB-style files is described here.)

Timeline for d5elmc1: