Lineage for d5dk3a2 (5dk3 A:111-218)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2362462Domain d5dk3a2: 5dk3 A:111-218 [279452]
    Other proteins in same PDB: d5dk3a1, d5dk3f1
    automated match to d1dn0a2
    complexed with bma, fuc, man, nag, so4, suc

Details for d5dk3a2

PDB Entry: 5dk3 (more details), 2.28 Å

PDB Description: crystal structure of pembrolizumab, a full length igg4 antibody
PDB Compounds: (A:) light chain

SCOPe Domain Sequences for d5dk3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dk3a2 b.1.1.2 (A:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d5dk3a2:

Click to download the PDB-style file with coordinates for d5dk3a2.
(The format of our PDB-style files is described here.)

Timeline for d5dk3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5dk3a1