SCOPe 2.07: Domain d5ctma_: 5ctm A:

Lineage for d5ctma_ (5ctm A:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Bacillus pumilus [TaxId:1408] [279437] (2 PDB entries)

8. Domain d5ctma_: 5ctm A: [279439]
   automated match to d3isga_
   complexed with edo, flc, peg

Details for d5ctma_

PDB Entry: 5ctm, 1 Å

PDB Description: structure of bpu1 beta-lactamase

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5ctma_:

Sequence; same for both SEQRES and ATOM records:

>d5ctma_ e.3.1.0 (A:) automated matches {Bacillus pumilus [TaxId: 1408]}
aiawsvdeffknregtfviqevkekspwvynkkrakerfapqstfkvanaliglqtgavr
deydikywdgvkreidnwnrdhtlgsgmrdsvvwyyqamardigeermnhwvkaihygnk
disggidqfwlsstlrispieqvrflkqlyeetlpfdlknmrtvkrmmvqeeekhatlyg
ktgsgsdigwyvgfikhehktyilatnikgtgieakdityrilkkyhlmeasv

Timeline for d5ctma_:

• d5ctma_ first appeared in SCOPe 2.05
  
• d5ctma_ appears in SCOPe 2.06
  
• d5ctma_ appears in the current release, SCOPe 2.08