Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
Protein automated matches [191164] (24 species) not a true protein |
Species Clostridium pasteurianum [TaxId:1501] [279203] (17 PDB entries) |
Domain d4xddb1: 4xdd B:1-126 [279357] Other proteins in same PDB: d4xdda2, d4xdda3, d4xdda4, d4xddb2, d4xddb3, d4xddb4 automated match to d3c8ya2 complexed with cl, fes, gol, mg, sf4 |
PDB Entry: 4xdd (more details), 1.6 Å
SCOPe Domain Sequences for d4xddb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xddb1 d.15.4.0 (B:1-126) automated matches {Clostridium pasteurianum [TaxId: 1501]} mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara skpflp
Timeline for d4xddb1:
View in 3D Domains from other chains: (mouse over for more information) d4xdda1, d4xdda2, d4xdda3, d4xdda4 |