Lineage for d4xddb1 (4xdd B:1-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2934202Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2934203Protein automated matches [191164] (24 species)
    not a true protein
  7. 2934207Species Clostridium pasteurianum [TaxId:1501] [279203] (17 PDB entries)
  8. 2934211Domain d4xddb1: 4xdd B:1-126 [279357]
    Other proteins in same PDB: d4xdda2, d4xdda3, d4xdda4, d4xddb2, d4xddb3, d4xddb4
    automated match to d3c8ya2
    complexed with cl, fes, gol, mg, sf4

Details for d4xddb1

PDB Entry: 4xdd (more details), 1.6 Å

PDB Description: apo [fefe]-hydrogenase cpi
PDB Compounds: (B:) Iron hydrogenase 1

SCOPe Domain Sequences for d4xddb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xddb1 d.15.4.0 (B:1-126) automated matches {Clostridium pasteurianum [TaxId: 1501]}
mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
skpflp

SCOPe Domain Coordinates for d4xddb1:

Click to download the PDB-style file with coordinates for d4xddb1.
(The format of our PDB-style files is described here.)

Timeline for d4xddb1: