SCOPe 2.05: Domain d5azel2: 5aze L:112-216

Lineage for d5azel2 (5aze L:112-216)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268989] (70 PDB entries)

8. Domain d5azel2: 5aze L:112-216 [279232]
   Other proteins in same PDB: d5azel1
   automated match to d3n9gl2
   complexed with ca

Details for d5azel2

PDB Entry: 5aze, 2.2 Å

PDB Description: fab fragment of calcium-dependent antigen binding antibody, 6rl#9

PDB Compounds: (L:) 6rl#9 fab light chain

SCOPe Domain Sequences for d5azel2:

Sequence; same for both SEQRES and ATOM records:

>d5azel2 b.1.1.2 (L:112-216) automated matches {Homo sapiens [TaxId: 9606]}
sqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpsk
qsnnkyaassylsltpeqwkshrsyscqvthegstvektvaptec

Timeline for d5azel2:

• d5azel2 is new in SCOPe 2.05-stable
  
• d5azel2 appears in SCOPe 2.06
  
• d5azel2 appears in the current release, SCOPe 2.08