| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (309 species) not a true protein |
| Species Medicago truncatula [TaxId:3880] [259991] (7 PDB entries) |
| Domain d5bsgg1: 5bsg G:6-169 [279135] Other proteins in same PDB: d5bsga2, d5bsgb2, d5bsgc2, d5bsgd2, d5bsge2, d5bsgf2, d5bsgg2, d5bsgh2, d5bsgi2, d5bsgj2 automated match to d2izzd1 complexed with cl, mpo, nap |
PDB Entry: 5bsg (more details), 1.95 Å
SCOPe Domain Sequences for d5bsgg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bsgg1 c.2.1.0 (G:6-169) automated matches {Medicago truncatula [TaxId: 3880]}
ipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvlssn
ddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfirv
mpntaatvgeaasvmslggaateedanlisqlfgsigkiwkadd
Timeline for d5bsgg1: