Lineage for d4zd6a_ (4zd6 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2455059Species Corynebacterium sp. [TaxId:1720] [279066] (4 PDB entries)
  8. 2455060Domain d4zd6a_: 4zd6 A: [279079]
    automated match to d2ag5b_
    complexed with cl, mes, mg

Details for d4zd6a_

PDB Entry: 4zd6 (more details), 1.6 Å

PDB Description: halohydrin hydrogen-halide-lyase, hheb
PDB Compounds: (A:) Halohydrin epoxidase B

SCOPe Domain Sequences for d4zd6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zd6a_ c.2.1.0 (A:) automated matches {Corynebacterium sp. [TaxId: 1720]}
ngrlagkrvlltnadaymgeatvqvfeeegaeviadhtdltkvgaaeevveraghidvlv
anfavdahfgvtvletdeelwqtayetivhplhricravlpqfyernkgkivvygsaaam
ryqegalaystarfaqrgyvtalgpeaarhnvnvnfiaqhwtqnkeyfwperiatdefke
dmarrvplgrlataredallalflasdesdfivgksiefdggwat

SCOPe Domain Coordinates for d4zd6a_:

Click to download the PDB-style file with coordinates for d4zd6a_.
(The format of our PDB-style files is described here.)

Timeline for d4zd6a_: