| Class b: All beta proteins [48724] (180 folds) |
| Fold b.15: HSP20-like chaperones [49763] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) ![]() |
| Family b.15.1.0: automated matches [191643] (1 protein) not a true family |
| Protein automated matches [191181] (10 species) not a true protein |
| Species Sulfolobus solfataricus [TaxId:555311] [279049] (3 PDB entries) |
| Domain d4yl9a_: 4yl9 A: [279050] automated match to d3aaca_ complexed with ca, edo |
PDB Entry: 4yl9 (more details), 2.35 Å
SCOPe Domain Sequences for d4yl9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yl9a_ b.15.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 555311]}
mnvimreigkkldelsrefyesvippidmyeeggelvvvadlagfnkdkisvrlsaqnel
iinaereiqyigtkyatqrplkihkvirlpvkvkrdsqvtakyengvltiripvegsvsi
rie
Timeline for d4yl9a_: