Lineage for d4yl9d_ (4yl9 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773837Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773838Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 2773941Family b.15.1.0: automated matches [191643] (1 protein)
    not a true family
  6. 2773942Protein automated matches [191181] (10 species)
    not a true protein
  7. 2773960Species Sulfolobus solfataricus [TaxId:555311] [279049] (3 PDB entries)
  8. 2773964Domain d4yl9d_: 4yl9 D: [279052]
    automated match to d3aaca_
    complexed with ca, edo

Details for d4yl9d_

PDB Entry: 4yl9 (more details), 2.35 Å

PDB Description: crystal structure of wild-type of hsp14.1 from sulfolobus solfatataricus p2
PDB Compounds: (D:) Heat shock protein Hsp20

SCOPe Domain Sequences for d4yl9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yl9d_ b.15.1.0 (D:) automated matches {Sulfolobus solfataricus [TaxId: 555311]}
mnvimreigkkldelsrefyesvippidmyeeggelvvvadlagfnkdkisvrlsaqnel
iinaereiqyigtkyatqrplkihkvirlpvkvkrdsqvtakyengvltiripvegsvsi
rie

SCOPe Domain Coordinates for d4yl9d_:

Click to download the PDB-style file with coordinates for d4yl9d_.
(The format of our PDB-style files is described here.)

Timeline for d4yl9d_: