Lineage for d4pifb1 (4pif B:1-141)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813105Fold b.77: beta-Prism I [51091] (4 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2813155Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2813299Family b.77.3.0: automated matches [191397] (1 protein)
    not a true family
  6. 2813300Protein automated matches [190516] (5 species)
    not a true protein
  7. 2813301Species Musa acuminata [TaxId:4641] [187471] (10 PDB entries)
  8. 2813313Domain d4pifb1: 4pif B:1-141 [278993]
    Other proteins in same PDB: d4pifa2, d4pifb2, d4pifc2, d4pifd2
    automated match to d2bmza_
    complexed with gol

Details for d4pifb1

PDB Entry: 4pif (more details), 1.7 Å

PDB Description: crystal structure of recombinant wt banana lectin
PDB Compounds: (B:) ripening-associated protein

SCOPe Domain Sequences for d4pifb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pifb1 b.77.3.0 (B:1-141) automated matches {Musa acuminata [TaxId: 4641]}
mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
tpheivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagk
isgffgrggkfldaigvylep

SCOPe Domain Coordinates for d4pifb1:

Click to download the PDB-style file with coordinates for d4pifb1.
(The format of our PDB-style files is described here.)

Timeline for d4pifb1: