SCOPe 2.05: Domain d5disc2: 5dis C:93-287

Lineage for d5disc2 (5dis C:93-287)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families)
   has a circularly permuted topology

5. Family d.142.2.5: m3G-cap binding domain of snurportin-1 [254171] (2 proteins)

6. Protein automated matches [278960] (1 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [278961] (1 PDB entry)

8. Domain d5disc2: 5dis C:93-287 [278962]
   Other proteins in same PDB: d5disb_, d5disc1
   automated match to d3gb8b1
   complexed with gtp, mal, mg, pro

Details for d5disc2

PDB Entry: 5dis, 2.85 Å

PDB Description: crystal structure of a crm1-rangtp-spn1 export complex bound to a 113 amino acid fg-repeat containing fragment of nup214

PDB Compounds: (C:) Snurportin-1

SCOPe Domain Sequences for d5disc2:

Sequence, based on SEQRES records:

>d5disc2 d.142.2.5 (C:93-287) automated matches {Homo sapiens [TaxId: 9606]}
klpkhyanqlmlsewlidvpsdlgqewivvvcpvgkralivasrgstsaytksgycvnrf
ssllpggnrrnstakdytildciynevnqtyyvldvmcwrghpfydcqtdfrfywmhskl
peeeglgektklnpfkfvglknfpctpeslcdvlsmdfpfevdgllfyhkqthyspgstp
lvgwlrpymvsdvlg

Sequence, based on observed residues (ATOM records):

>d5disc2 d.142.2.5 (C:93-287) automated matches {Homo sapiens [TaxId: 9606]}
klpkhyanqlmlsewlidvpsdlgqewivvvcpvgkralivasrgstsaytksgycvnrf
ssllpggnrrakdytildciynevnqtyyvldvmcwrghpfydcqtdfrfywmhsklpee
eglgektklnpfkfvglknfpctpeslcdvlsmdfpfevdgllfyhkqthyspgstplvg
wlrpymvsdvlg

Timeline for d5disc2:

• d5disc2 is new in SCOPe 2.05-stable
  
• d5disc2 appears in SCOPe 2.06
  
• d5disc2 appears in the current release, SCOPe 2.08