Lineage for d5disc2 (5dis C:93-287)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217840Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. 2217912Family d.142.2.5: m3G-cap binding domain of snurportin-1 [254171] (2 proteins)
  6. 2217917Protein automated matches [278960] (1 species)
    not a true protein
  7. 2217918Species Human (Homo sapiens) [TaxId:9606] [278961] (1 PDB entry)
  8. 2217919Domain d5disc2: 5dis C:93-287 [278962]
    Other proteins in same PDB: d5disb_, d5disc1
    automated match to d3gb8b1
    complexed with gtp, mal, mg, pro

Details for d5disc2

PDB Entry: 5dis (more details), 2.85 Å

PDB Description: crystal structure of a crm1-rangtp-spn1 export complex bound to a 113 amino acid fg-repeat containing fragment of nup214
PDB Compounds: (C:) Snurportin-1

SCOPe Domain Sequences for d5disc2:

Sequence, based on SEQRES records: (download)

>d5disc2 d.142.2.5 (C:93-287) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klpkhyanqlmlsewlidvpsdlgqewivvvcpvgkralivasrgstsaytksgycvnrf
ssllpggnrrnstakdytildciynevnqtyyvldvmcwrghpfydcqtdfrfywmhskl
peeeglgektklnpfkfvglknfpctpeslcdvlsmdfpfevdgllfyhkqthyspgstp
lvgwlrpymvsdvlg

Sequence, based on observed residues (ATOM records): (download)

>d5disc2 d.142.2.5 (C:93-287) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klpkhyanqlmlsewlidvpsdlgqewivvvcpvgkralivasrgstsaytksgycvnrf
ssllpggnrrakdytildciynevnqtyyvldvmcwrghpfydcqtdfrfywmhsklpee
eglgektklnpfkfvglknfpctpeslcdvlsmdfpfevdgllfyhkqthyspgstplvg
wlrpymvsdvlg

SCOPe Domain Coordinates for d5disc2:

Click to download the PDB-style file with coordinates for d5disc2.
(The format of our PDB-style files is described here.)

Timeline for d5disc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5disc1
View in 3D
Domains from other chains:
(mouse over for more information)
d5disb_