Lineage for d4ufza_ (4ufz A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217840Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. 2217920Family d.142.2.0: automated matches [227263] (1 protein)
    not a true family
  6. 2217921Protein automated matches [227054] (4 species)
    not a true protein
  7. 2217924Species Haemophilus influenzae [TaxId:727] [226055] (8 PDB entries)
  8. 2217930Domain d4ufza_: 4ufz A: [278761]
    automated match to d1taea_
    complexed with ia7, iwh

Details for d4ufza_

PDB Entry: 4ufz (more details), 2.33 Å

PDB Description: synthesis of novel nad dependant dna ligase inhibitors via negishi cross-coupling: development of sar and resistance studies
PDB Compounds: (A:) DNA ligase

SCOPe Domain Sequences for d4ufza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ufza_ d.142.2.0 (A:) automated matches {Haemophilus influenzae [TaxId: 727]}
mtniqtqldnlrktlrqyeyeyhvldnpsvpdseydrlfhqlkalelehpefltsdsptq
rvgakplsgfsqirheipmlsldnafsdaefnafvkriedrlillpkpltfccepkldgl
avsilyvngeltqaatrgdgttgeditanirtirnvplqlltdnpparlevrgevfmpha
gferlnkyalehnektfanprnaaagslrqldpnitskrplvlnaygigiaegvdlptth
yarlqwlksigipvnpeirlcngadevlgfyrdiqnkrsslgydidgtvlkindialqne
lgfiskaprwaiaykfp

SCOPe Domain Coordinates for d4ufza_:

Click to download the PDB-style file with coordinates for d4ufza_.
(The format of our PDB-style files is described here.)

Timeline for d4ufza_: