Lineage for d5dedh_ (5ded H:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612756Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2612757Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2613165Family d.218.1.8: RelA/SpoT domain [102945] (3 proteins)
    Pfam PF04607; ppGpp-synthetase
  6. 2613174Protein automated matches [254696] (3 species)
    not a true protein
  7. 2613175Species Bacillus subtilis [TaxId:1415167] [278587] (2 PDB entries)
  8. 2613195Domain d5dedh_: 5ded H: [278607]
    automated match to d2be3a1
    complexed with 0o2, mg

Details for d5dedh_

PDB Entry: 5ded (more details), 2.94 Å

PDB Description: crystal structure of the small alarmone synthethase 1 from bacillus subtilis bound to its product pppgpp
PDB Compounds: (H:) GTP pyrophosphokinase YjbM

SCOPe Domain Sequences for d5dedh_:

Sequence, based on SEQRES records: (download)

>d5dedh_ d.218.1.8 (H:) automated matches {Bacillus subtilis [TaxId: 1415167]}
dkqwerflvpyrqaveelkvklkgirtlyeyeddhspiefvtgrvkpvasilekarrksi
plheietmqdiaglrimcqfvddiqivkemlfarkdftvvdqrdyiaehkesgyrsyhlv
vlyplqtvsgekhvlveiqirtlamnfwatiehslnykysgnipekvklrlqraseaasr
ldeemseirgevqeaqaa

Sequence, based on observed residues (ATOM records): (download)

>d5dedh_ d.218.1.8 (H:) automated matches {Bacillus subtilis [TaxId: 1415167]}
dkqwerflvpyrqaveelkvklkgirtlyeyeddhspiefvtgrvkpvasilekarrksi
plheietmqdiaglrimcqfvddiqivkemlfarkdftvvdqrdyiaehkesgyrsyhlv
vlyplqtvsgekhvlveiqirtlamnfwatiehslnykysgnipekvklrlqraseaasr
ldeemseirgevaa

SCOPe Domain Coordinates for d5dedh_:

Click to download the PDB-style file with coordinates for d5dedh_.
(The format of our PDB-style files is described here.)

Timeline for d5dedh_: