Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) |
Family d.218.1.8: RelA/SpoT domain [102945] (3 proteins) Pfam PF04607; ppGpp-synthetase |
Protein automated matches [254696] (3 species) not a true protein |
Species Bacillus subtilis [TaxId:1415167] [278587] (2 PDB entries) |
Domain d5dedb_: 5ded B: [278605] automated match to d2be3a1 complexed with 0o2, mg |
PDB Entry: 5ded (more details), 2.94 Å
SCOPe Domain Sequences for d5dedb_:
Sequence, based on SEQRES records: (download)
>d5dedb_ d.218.1.8 (B:) automated matches {Bacillus subtilis [TaxId: 1415167]} dkqwerflvpyrqaveelkvklkgirtlyeyeddhspiefvtgrvkpvasilekarrksi plheietmqdiaglrimcqfvddiqivkemlfarkdftvvdqrdyiaehkesgyrsyhlv vlyplqtvsgekhvlveiqirtlamnfwatiehslnykysgnipekvklrlqraseaasr ldeemseirgevqeaqaa
>d5dedb_ d.218.1.8 (B:) automated matches {Bacillus subtilis [TaxId: 1415167]} dkqwerflvpyrqaveelkvklkgirtlyeyeddhspiefvtgrvkpvasilekarrksi plheietmqdiaglrimcqfvddiqivkemlfarkdftvvdqrdyiaehkesgyrsyhlv vlyplqtvsgekhvlveiqirtlamnfwatiehslnyksgnekvklrlqraseaasrlde emseirgevaa
Timeline for d5dedb_: