SCOPe 2.06: Domain d4ybnb_: 4ybn B:

Lineage for d4ybnb_ (4ybn B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.0: automated matches [191365] (1 protein)
   not a true family

6. Protein automated matches [190439] (20 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [278309] (2 PDB entries)

8. Domain d4ybnb_: 4ybn B: [278463]
   automated match to d2fura1
   complexed with act, fad, hem, ni, so4

Details for d4ybnb_

PDB Entry: 4ybn, 1.9 Å

PDB Description: structure of the fad and heme binding protein msmeg_4975 from mycobacterium smegmatis

PDB Compounds: (B:) Flavin-nucleotide-binding protein

SCOPe Domain Sequences for d4ybnb_:

Sequence; same for both SEQRES and ATOM records:

>d4ybnb_ b.45.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
ekqstsrerlddlldtiplatvalvrdghpvafpigfgrvgdelvihgstgspwlralae
gapaavsvtaldgvvvarssfessfryrsatlfgtfeviaddakrgyldaltdrfipgrt
aelrastrkelaatlalalaigddnwslklsegwpddadediaaggwagvvplttqygap
ltapdvaagtplppsvrgmtgelrn

Timeline for d4ybnb_:

• d4ybnb_ first appeared in SCOPe 2.05
  
• d4ybnb_ appears in SCOPe 2.07
  
• d4ybnb_ appears in the current release, SCOPe 2.08