Lineage for d4wyta1 (4wyt A:3-105)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2379659Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2379660Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2379661Family b.36.1.1: PDZ domain [50157] (47 protein domains)
    Pfam PF00595
  6. 2379841Protein Scribble (KIAA0147) [101731] (1 species)
  7. 2379842Species Human (Homo sapiens) [TaxId:9606] [101732] (6 PDB entries)
    Uniprot Q14160 680-951, 1096-1193 # structure of 1st PDZ domain is also known, 1XQ5
  8. 2379846Domain d4wyta1: 4wyt A:3-105 [278457]
    automated match to d1mfga_
    complexed with cl

Details for d4wyta1

PDB Entry: 4wyt (more details), 2.6 Å

PDB Description: crystal structure of scribble pdz34 tandem at 2.6 angstroms
PDB Compounds: (A:) Protein scribble homolog

SCOPe Domain Sequences for d4wyta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wyta1 b.36.1.1 (A:3-105) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]}
aaalegpypveeirlpraggplglsivggsdhsshpfgvqepgvfiskvlprglaarsgl
rvgdrilavngqdvrdathqeavsallrpclelsllvrrdpap

SCOPe Domain Coordinates for d4wyta1:

Click to download the PDB-style file with coordinates for d4wyta1.
(The format of our PDB-style files is described here.)

Timeline for d4wyta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wyta2