Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (91 species) not a true protein |
Species Peptoclostridium difficile [TaxId:525259] [278443] (1 PDB entry) |
Domain d4woqf_: 4woq F: [278444] automated match to d2ygya_ complexed with 2kt |
PDB Entry: 4woq (more details), 2.2 Å
SCOPe Domain Sequences for d4woqf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4woqf_ c.1.10.0 (F:) automated matches {Peptoclostridium difficile [TaxId: 525259]} tdmkgiysallvsfdkegninekglrqiirhnidvckvdglyvggstgenfmlstdekkr ifeiakdevkeeikliaqvgsvnlkeavelakfttdlgydaisavtpfyykfdfeeikhy yntiinsvdnrliiysipfltgvdmsldqfgelfenekiigvkftaadfyllermrktfp nklifagfdemmlpatvlgvdgaigstfnvngvrarqifeltknekisealevqhvtndl itdilgnglyqtikllleeqgveagycrqpmkeatdemksrakeiyrkyf
Timeline for d4woqf_: