SCOPe 2.08: Domain d4tl4b_: 4tl4 B:

Lineage for d4tl4b_ (4tl4 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries)
   Uniprot P02766 31-143

8. Domain d4tl4b_: 4tl4 B: [278407]
   automated match to d1ttca_
   mutant

Details for d4tl4b_

PDB Entry: 4tl4, 1.75 Å

PDB Description: crystal structure of human transthyretin val30met mutant

PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d4tl4b_:

Sequence; same for both SEQRES and ATOM records:

>d4tl4b_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

Timeline for d4tl4b_:

• d4tl4b_ first appeared in SCOPe 2.05
  
• d4tl4b_ appears in SCOPe 2.07