Lineage for d5de0d_ (5de0 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950158Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2950159Protein automated matches [190081] (33 species)
    not a true protein
  7. 2950555Species Vibrio cholerae [TaxId:666] [278345] (1 PDB entry)
  8. 2950559Domain d5de0d_: 5de0 D: [278350]
    automated match to d2iiza_
    complexed with hem

Details for d5de0d_

PDB Entry: 5de0 (more details), 2.24 Å

PDB Description: dye-decolorizing protein from v. cholerae
PDB Compounds: (D:) Deferrochelatase

SCOPe Domain Sequences for d5de0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5de0d_ d.58.4.0 (D:) automated matches {Vibrio cholerae [TaxId: 666]}
sqtailpeagpfalytllkvrqnhahvlqalkalpalveeinqnqpgaeltvsvafskgf
wshfemasppelidfpelgegethapstdvdvlihchatrhdllfytlrkgisdiaqdie
ivdetygfryldardmtgfidgtenpkaekraevalvadgdfaggsyvmvqrfvhnlpaw
nrlnlaaqekvigrtkpdsvelenvpaashvgrvdikeegkglkivrhslpygsvsgdhg
llfiaychtlhnfktmlesmygvtdgktdqllrftkavtgayffapsqvmlqeltl

SCOPe Domain Coordinates for d5de0d_:

Click to download the PDB-style file with coordinates for d5de0d_.
(The format of our PDB-style files is described here.)

Timeline for d5de0d_: