| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.33: Sec2 N-terminal region [144284] (1 family) ![]() dimeric coiled coil |
| Family h.1.33.1: Sec2 N-terminal region [144285] (2 proteins) |
| Protein Rab guanine nucleotide exchange factor Sec2 [144286] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [278245] (1 PDB entry) |
| Domain d4zdwc1: 4zdw C:51-140 [278247] Other proteins in same PDB: d4zdwa_, d4zdwb2, d4zdwc2 automated match to d2eqbc_ complexed with gdp; mutant |
PDB Entry: 4zdw (more details), 2.9 Å
SCOPe Domain Sequences for d4zdwc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zdwc1 h.1.33.1 (C:51-140) Rab guanine nucleotide exchange factor Sec2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nynqlkedyntlkrelsdrddevkrlrediakenelrtkaeeeadklnkevedltaslfd
eannmvadarkekyaieilnkrlteqlrek
Timeline for d4zdwc1: