Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein Carbonyl reductase/20beta-hydroxysteroid dehydrogenase [63935] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [141878] (6 PDB entries) Uniprot P16152 2-276 |
Domain d4z3dc_: 4z3d C: [278234] automated match to d1wmaa1 complexed with gsh, ndp |
PDB Entry: 4z3d (more details), 1.8 Å
SCOPe Domain Sequences for d4z3dc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z3dc_ c.2.1.2 (C:) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} gihvalvtggnkgiglaivrdlcrlfsgdvvltardvtrgqaavqqlqaeglsprfhqld iddlqsiralrdflrkeyggldvlvnnagiafkvadptpfhiqaevtmktnffgtrdvct ellplikpqgrvvnvssimsvralkscspelqqkfrsetiteeelvglmnkfvedtkkgv hqkegwpssaygvtkigvtvlsriharklseqrkgdkillnaccpgwvrtdmagpkatks peegaetpvylallppdaegphgqfvsekrveqw
Timeline for d4z3dc_: