Lineage for d1crma_ (1crm A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 961516Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 961517Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 961518Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
  6. 961519Protein Carbonic anhydrase [51071] (10 species)
  7. 961525Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (16 PDB entries)
  8. 961538Domain d1crma_: 1crm A: [27816]
    complexed with cl, h2s, hg

Details for d1crma_

PDB Entry: 1crm (more details), 2 Å

PDB Description: structure and function of carbonic anhydrases
PDB Compounds: (A:) carbonic anhydrase I

SCOPe Domain Sequences for d1crma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1crma_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
sfhvnfednqdrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
nrptqplkgrtvrasf

SCOPe Domain Coordinates for d1crma_:

Click to download the PDB-style file with coordinates for d1crma_.
(The format of our PDB-style files is described here.)

Timeline for d1crma_: