Lineage for d1dkga1 (1dkg A:139-197)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804990Fold b.73: Head domain of nucleotide exchange factor GrpE [51063] (1 superfamily)
    small mixed beta-sheet, 4 "generalized" strands
  4. 1804991Superfamily b.73.1: Head domain of nucleotide exchange factor GrpE [51064] (1 family) (S)
  5. 1804992Family b.73.1.1: Head domain of nucleotide exchange factor GrpE [51065] (1 protein)
  6. 1804993Protein Head domain of nucleotide exchange factor GrpE [51066] (1 species)
  7. 1804994Species Escherichia coli [TaxId:562] [51067] (1 PDB entry)
  8. 1804995Domain d1dkga1: 1dkg A:139-197 [27812]
    Other proteins in same PDB: d1dkga2, d1dkgb2, d1dkgd1, d1dkgd2

Details for d1dkga1

PDB Entry: 1dkg (more details), 2.8 Å

PDB Description: crystal structure of the nucleotide exchange factor grpe bound to the atpase domain of the molecular chaperone dnak
PDB Compounds: (A:) nucleotide exchange factor grpe

SCOPe Domain Sequences for d1dkga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkga1 b.73.1.1 (A:139-197) Head domain of nucleotide exchange factor GrpE {Escherichia coli [TaxId: 562]}
veviaetnvpldpnvhqaiamvesddvapgnvlgimqkgytlngrtiraamvtvakaka

SCOPe Domain Coordinates for d1dkga1:

Click to download the PDB-style file with coordinates for d1dkga1.
(The format of our PDB-style files is described here.)

Timeline for d1dkga1: