SCOPe 2.08: Domain d1dkga1: 1dkg A:139-197

Lineage for d1dkga1 (1dkg A:139-197)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.73: Head domain of nucleotide exchange factor GrpE [51063] (1 superfamily)
   small mixed beta-sheet, 4 "generalized" strands

4. Superfamily b.73.1: Head domain of nucleotide exchange factor GrpE [51064] (1 family)

5. Family b.73.1.1: Head domain of nucleotide exchange factor GrpE [51065] (1 protein)

6. Protein Head domain of nucleotide exchange factor GrpE [51066] (1 species)

7. Species Escherichia coli [TaxId:562] [51067] (1 PDB entry)

8. Domain d1dkga1: 1dkg A:139-197 [27812]
   Other proteins in same PDB: d1dkga2, d1dkgb2, d1dkgd1, d1dkgd2

Details for d1dkga1

PDB Entry: 1dkg, 2.8 Å

PDB Description: crystal structure of the nucleotide exchange factor grpe bound to the atpase domain of the molecular chaperone dnak

PDB Compounds: (A:) nucleotide exchange factor grpe

SCOPe Domain Sequences for d1dkga1:

Sequence; same for both SEQRES and ATOM records:

>d1dkga1 b.73.1.1 (A:139-197) Head domain of nucleotide exchange factor GrpE {Escherichia coli [TaxId: 562]}
veviaetnvpldpnvhqaiamvesddvapgnvlgimqkgytlngrtiraamvtvakaka

Timeline for d1dkga1:

• d1dkga1 first appeared (with stable ids) in SCOP 1.55
  
• d1dkga1 appears in SCOPe 2.07