SCOP 1.65: Domain d1e15b1: 1e15 B:447-499

Lineage for d1e15b1 (1e15 B:447-499)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.72: WW domain-like [51044] (2 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family)

5. Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)

6. Protein Chitinase B, C-terminal domain [51061] (1 species)

7. Species Serratia marcescens [TaxId:615] [51062] (10 PDB entries)

8. Domain d1e15b1: 1e15 B:447-499 [27811]
   Other proteins in same PDB: d1e15a2, d1e15a3, d1e15b2, d1e15b3

Details for d1e15b1

PDB Entry: 1e15, 1.9 Å

PDB Description: chitinase b from serratia marcescens

SCOP Domain Sequences for d1e15b1:

Sequence; same for both SEQRES and ATOM records:

>d1e15b1 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva

Timeline for d1e15b1:

• d1e15b1 first appeared (with stable ids) in SCOP 1.55
  
• d1e15b1 appears in SCOP 1.63
  
• d1e15b1 appears in SCOP 1.67
  
• d1e15b1 appears in the current release, SCOPe 2.08