Lineage for d1e15b1 (1e15 B:447-499)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 233857Fold b.72: WW domain-like [51044] (2 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 233890Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) (S)
  5. 233891Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)
  6. 233898Protein Chitinase B, C-terminal domain [51061] (1 species)
  7. 233899Species Serratia marcescens [TaxId:615] [51062] (9 PDB entries)
  8. 233905Domain d1e15b1: 1e15 B:447-499 [27811]
    Other proteins in same PDB: d1e15a2, d1e15a3, d1e15b2, d1e15b3

Details for d1e15b1

PDB Entry: 1e15 (more details), 1.9 Å

PDB Description: chitinase b from serratia marcescens

SCOP Domain Sequences for d1e15b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e15b1 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva

SCOP Domain Coordinates for d1e15b1:

Click to download the PDB-style file with coordinates for d1e15b1.
(The format of our PDB-style files is described here.)

Timeline for d1e15b1: