![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Plant alpha-amylase [51040] (2 species) single beta-sheet; probable result of a decay of the common-fold |
![]() | Species Barley (Hordeum vulgare), seeds, AMY2 isozyme [TaxId:4513] [51041] (3 PDB entries) |
![]() | Domain d1bg9a1: 1bg9 A:347-403 [27800] Other proteins in same PDB: d1bg9a2 complexed with af1, ca heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures |
PDB Entry: 1bg9 (more details), 2.8 Å
SCOPe Domain Sequences for d1bg9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bg9a1 b.71.1.1 (A:347-403) Plant alpha-amylase {Barley (Hordeum vulgare), seeds, AMY2 isozyme [TaxId: 4513]} hnesklqiieadadlylaeidgkvivklgprydvgnlipggfkvaahgndyavweki
Timeline for d1bg9a1: