SCOPe 2.08: Domain d1bg9a1: 1bg9 A:347-403

Lineage for d1bg9a1 (1bg9 A:347-403)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Plant alpha-amylase [51040] (2 species)
   single beta-sheet; probable result of a decay of the common-fold

7. Species Barley (Hordeum vulgare), seeds, AMY2 isozyme [TaxId:4513] [51041] (3 PDB entries)

8. Domain d1bg9a1: 1bg9 A:347-403 [27800]
   Other proteins in same PDB: d1bg9a2
   complexed with af1, ca
   heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures

Details for d1bg9a1

PDB Entry: 1bg9, 2.8 Å

PDB Description: barley alpha-amylase with substrate analogue acarbose

PDB Compounds: (A:) 1,4-alpha-d-glucan glucanohydrolase

SCOPe Domain Sequences for d1bg9a1:

Sequence; same for both SEQRES and ATOM records:

>d1bg9a1 b.71.1.1 (A:347-403) Plant alpha-amylase {Barley (Hordeum vulgare), seeds, AMY2 isozyme [TaxId: 4513]}
hnesklqiieadadlylaeidgkvivklgprydvgnlipggfkvaahgndyavweki

Timeline for d1bg9a1:

• d1bg9a1 first appeared (with stable ids) in SCOP 1.55, called d1bg9_1
  
• d1bg9a1 appears in SCOPe 2.07