PDB entry 1bg9

View 1bg9 on RCSB PDB site
Description: barley alpha-amylase with substrate analogue acarbose
Class: hydrolase
Keywords: hydrolase, o-glycosyl
Deposited on 1998-06-05, released 1999-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.151
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-alpha-d-glucan glucanohydrolase
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bg9a1, d1bg9a2
  • Heterogens: CA, AF1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bg9A (A:)
    qvlfqgfnweswkhnggwynflmgkvddiaaagithvwlppasqsvaeqgympgrlydld
    askygnkaqlksligalhgkgvkaiadivinhrtaehkdgrgiycifeggtpdarldwgp
    hmicrddrpyadgtgnpdtgadfgaapdidhlnlrvqkelvewlnwlkadigfdgwrfdf
    akgysadvakiyidrsepsfavaeiwtslayggdgkpnlnqdqhrqelvnwvdkvggkgp
    attfdfttkgilnvavegelwrlrgtdgkapgmigwwpakavtfvdnhdtgstqhmwpfp
    sdrvmqgyayilthpgtpcifydhffdwglkeeidrlvsvrtrhgihnesklqiieadad
    lylaeidgkvivklgprydvgnlipggfkvaahgndyavweki