SCOPe 2.07: Domain d4ygoe_: 4ygo E:

Lineage for d4ygoe_ (4ygo E:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (48 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [188612] (22 PDB entries)

8. Domain d4ygoe_: 4ygo E: [277990]
   automated match to d3eg7b_
   complexed with ca, moh

Details for d4ygoe_

PDB Entry: 4ygo, 2.5 Å

PDB Description: dodecameric structure of spermidine n-acetyltransferase from vibrio cholerae in intermediate state

PDB Compounds: (E:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d4ygoe_:

Sequence; same for both SEQRES and ATOM records:

>d4ygoe_ d.108.1.0 (E:) automated matches {Vibrio cholerae [TaxId: 666]}
qltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvveda
qknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiylhv
avenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskyln

Timeline for d4ygoe_:

• d4ygoe_ first appeared in SCOPe 2.05
  
• d4ygoe_ appears in SCOPe 2.06
  
• d4ygoe_ appears in the current release, SCOPe 2.08