Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein automated matches [190095] (28 species) not a true protein |
Species Escherichia coli [TaxId:83333] [277890] (11 PDB entries) |
Domain d4rz4d1: 4rz4 D:2-220 [277913] Other proteins in same PDB: d4rz4a2, d4rz4b2, d4rz4c2, d4rz4d2, d4rz4e2, d4rz4f2, d4rz4g2, d4rz4h2, d4rz4i2, d4rz4j2 automated match to d1l6wa_ complexed with cl, pge, po4 |
PDB Entry: 4rz4 (more details), 1.75 Å
SCOPe Domain Sequences for d4rz4d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rz4d1 c.1.10.1 (D:2-220) automated matches {Escherichia coli [TaxId: 83333]} elyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaevm attaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqgllsa lagaeyvapfvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllagc esitlpldvaqqmisypavdaavakfeqdwqgafgrtsi
Timeline for d4rz4d1: