SCOPe 2.08: Domain d4rz4d1: 4rz4 D:2-220

Lineage for d4rz4d1 (4rz4 D:2-220)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (28 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [277890] (11 PDB entries)

8. Domain d4rz4d1: 4rz4 D:2-220 [277913]
   Other proteins in same PDB: d4rz4a2, d4rz4b2, d4rz4c2, d4rz4d2, d4rz4e2, d4rz4f2, d4rz4g2, d4rz4h2, d4rz4i2, d4rz4j2
   automated match to d1l6wa_
   complexed with cl, pge, po4

Details for d4rz4d1

PDB Entry: 4rz4, 1.75 Å

PDB Description: fructose-6-phosphate aldolase q59e y131f from e.coli

PDB Compounds: (D:) Fructose-6-phosphate aldolase 1

SCOPe Domain Sequences for d4rz4d1:

Sequence; same for both SEQRES and ATOM records:

>d4rz4d1 c.1.10.1 (D:2-220) automated matches {Escherichia coli [TaxId: 83333]}
elyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaevm
attaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqgllsa
lagaeyvapfvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllagc
esitlpldvaqqmisypavdaavakfeqdwqgafgrtsi

Timeline for d4rz4d1:

• d4rz4d1 first appeared in SCOPe 2.05, called d4rz4d_
  
• d4rz4d1 appears in SCOPe 2.07