Lineage for d5cdfa1 (5cdf A:24-94)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1795771Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1795772Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) (S)
    automatically mapped to Pfam PF02874
  5. 1795900Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 1795901Protein automated matches [254527] (7 species)
    not a true protein
  7. 1795991Species Paracoccus denitrificans [TaxId:266] [277840] (1 PDB entry)
  8. 1795992Domain d5cdfa1: 5cdf A:24-94 [277847]
    Other proteins in same PDB: d5cdfa2, d5cdfa3, d5cdfe2, d5cdfe3
    automated match to d1maba2
    complexed with gol, po4

Details for d5cdfa1

PDB Entry: 5cdf (more details), 2.3 Å

PDB Description: structure at 2.3 a of the alpha/beta monomer of the f-atpase from paracoccus denitrificans
PDB Compounds: (A:) ATP synthase subunit alpha

SCOPe Domain Sequences for d5cdfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cdfa1 b.49.1.0 (A:24-94) automated matches {Paracoccus denitrificans [TaxId: 266]}
evaevgqvlsvgdgiarvygldkvqagemvefpggirgmvlnletdnvgvvifgddrdik
egdtvkrtgai

SCOPe Domain Coordinates for d5cdfa1:

Click to download the PDB-style file with coordinates for d5cdfa1.
(The format of our PDB-style files is described here.)

Timeline for d5cdfa1: