Class b: All beta proteins [48724] (180 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (17 species) not a true protein |
Species Paracoccus denitrificans [TaxId:266] [277840] (1 PDB entry) |
Domain d5cdfa1: 5cdf A:24-94 [277847] Other proteins in same PDB: d5cdfa2, d5cdfa3, d5cdfe2, d5cdfe3 automated match to d1maba2 complexed with gol, po4 |
PDB Entry: 5cdf (more details), 2.3 Å
SCOPe Domain Sequences for d5cdfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cdfa1 b.49.1.0 (A:24-94) automated matches {Paracoccus denitrificans [TaxId: 266]} evaevgqvlsvgdgiarvygldkvqagemvefpggirgmvlnletdnvgvvifgddrdik egdtvkrtgai
Timeline for d5cdfa1: