Lineage for d4zb9b1 (4zb9 B:3-95)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134024Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226685] (10 PDB entries)
  8. 2134047Domain d4zb9b1: 4zb9 B:3-95 [277711]
    Other proteins in same PDB: d4zb9a2, d4zb9b2, d4zb9c2, d4zb9d2
    automated match to d1k0ba2
    complexed with cl, gds

Details for d4zb9b1

PDB Entry: 4zb9 (more details), 2.4 Å

PDB Description: crystal structure of the glutathione transferase ure2p8 from phanerochaete chrysosporium, with one glutathione disulfide bound per dimer.
PDB Compounds: (B:) PcUre2p8

SCOPe Domain Sequences for d4zb9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zb9b1 c.47.1.0 (B:3-95) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
shdkqfslflhkasahgwkvafvleelslsyeivlvdvakneqkspefmklnpngrtpal
idhgnsdfviwesnamvqyvadkydterkisma

SCOPe Domain Coordinates for d4zb9b1:

Click to download the PDB-style file with coordinates for d4zb9b1.
(The format of our PDB-style files is described here.)

Timeline for d4zb9b1: