Lineage for d1pig_1 (1pig 404-496)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 114424Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 114425Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 114426Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (12 proteins)
  6. 114432Protein Animal alpha-amylase [51024] (3 species)
  7. 114447Species Pig (Sus scrofa) [TaxId:9823] [51025] (8 PDB entries)
  8. 114452Domain d1pig_1: 1pig 404-496 [27764]
    Other proteins in same PDB: d1pig_2

Details for d1pig_1

PDB Entry: 1pig (more details), 2.2 Å

PDB Description: pig pancreatic alpha-amylase complexed with the oligosaccharide v-1532

SCOP Domain Sequences for d1pig_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pig_1 b.71.1.1 (404-496) Animal alpha-amylase {Pig (Sus scrofa)}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycnvisgdkvgnsct
gikvyvssdgtaqfsisnsaqdpfiaihaeskl

SCOP Domain Coordinates for d1pig_1:

Click to download the PDB-style file with coordinates for d1pig_1.
(The format of our PDB-style files is described here.)

Timeline for d1pig_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pig_2