| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (203 species) not a true protein |
| Species Lactobacillus kefiri [TaxId:33962] [277547] (4 PDB entries) |
| Domain d4rf3b_: 4rf3 B: [277557] automated match to d2rhcb_ complexed with gol, mg; mutant |
PDB Entry: 4rf3 (more details), 1.69 Å
SCOPe Domain Sequences for d4rf3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rf3b_ c.2.1.0 (B:) automated matches {Lactobacillus kefiri [TaxId: 33962]}
drlkgkvaivtggtlgiglaiadkfveegakvvitgrhadvgekaaksiggtdvirfvqh
dasdeagwtklfdtteeafgpvttvvnnagifvsksvedttteewrkllsvnldgvffgt
rlgiqrmknkglgasiinmssiegfvgdptlgaynaskgavrimsksaaldcalkdydvr
vntvhpgyiktplvddlegaeemmsqrtktpmghigepndiawicvylasdeskfatgae
fvvdggytaq
Timeline for d4rf3b_: