Class b: All beta proteins [48724] (149 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Cyclodextrin glycosyltransferase [51018] (5 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [51021] (2 PDB entries) |
Domain d1qhoa3: 1qho A:408-495 [27751] Other proteins in same PDB: d1qhoa1, d1qhoa2, d1qhoa4 complexed with abd, ca, mal, so4 |
PDB Entry: 1qho (more details), 1.7 Å
SCOP Domain Sequences for d1qhoa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qhoa3 b.71.1.1 (A:408-495) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase} gtttqrwinndvyiyerkffndvvlvainrntqssysisglqtalpngsyadylsgllgg ngisvsngsvasftlapgavsvwqysts
Timeline for d1qhoa3: