Lineage for d1qhoa3 (1qho A:408-495)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17288Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 17289Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 17290Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins)
  6. 17324Protein Cyclodextrin glycosyltransferase [51018] (5 species)
  7. 17363Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [51021] (2 PDB entries)
  8. 17364Domain d1qhoa3: 1qho A:408-495 [27751]
    Other proteins in same PDB: d1qhoa1, d1qhoa2, d1qhoa4

Details for d1qhoa3

PDB Entry: 1qho (more details), 1.7 Å

PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose/acarbose complex

SCOP Domain Sequences for d1qhoa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhoa3 b.71.1.1 (A:408-495) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase}
gtttqrwinndvyiyerkffndvvlvainrntqssysisglqtalpngsyadylsgllgg
ngisvsngsvasftlapgavsvwqysts

SCOP Domain Coordinates for d1qhoa3:

Click to download the PDB-style file with coordinates for d1qhoa3.
(The format of our PDB-style files is described here.)

Timeline for d1qhoa3: